The domain within your query sequence starts at position 21 and ends at position 132; the E-value for the IL5 domain shown below is 5.3e-64.
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRG GTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAME
IL5 |
 |
|---|
| PFAM accession number: | PF02025 |
|---|---|
| Interpro abstract (IPR000186): | This entry represents interleukin-5 (IL5), also known as eosinophil differentiation factor (EDF), is a lineage-specific cytokine for eosinophilpoiesis [ (PUBMED:3498940) (PUBMED:8483502) ]. It regulates eosinophil growth and activation [ (PUBMED:3498940) ], and thus plays an important role in diseases associated with increased levels of eosinophils, including asthma [ (PUBMED:8483502) ]. IL5 has a similar overall fold to other cytokines (e.g., IL2, IL4 and GCSF) [ (PUBMED:8483502) ], but while these exist as monomeric structures, IL5 is a homodimer. The fold contains an anti-parallel 4-alpha-helix bundle with a left handed twist, connected by a 2-stranded anti-parallel beta-sheet [ (PUBMED:8483502) (PUBMED:2037074) ]. The monomers are held together by 2 interchain disulphide bonds [ (PUBMED:2037074) ]. |
| GO process: | immune response (GO:0006955) |
| GO component: | extracellular region (GO:0005576) |
| GO function: | growth factor activity (GO:0008083), interleukin-5 receptor binding (GO:0005137) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL5