The domain within your query sequence starts at position 15 and ends at position 141; the E-value for the IL7 domain shown below is 1.6e-46.
SVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLL QLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQK TEMQRQK
IL7 |
---|
PFAM accession number: | PF01415 |
---|---|
Interpro abstract (IPR001181): | This entry represents interleukin-7 (IL7), it is a hematopoietic growth factor produced by bone marrow stromal cells. It promotes growth of B- and T-cell precursors and functions with IL2 in the activation of mature T-cells [ (PUBMED:2643102) (PUBMED:3259677) ]. IL-7 and IL-7Ralpha bind the gamma-c receptor forming a complex required for the development and homeostasis of T and B cells [ (PUBMED:19141282) ]. Interleukin-7 and Interleukin-9 belong to the same larger family. |
GO process: | immune response (GO:0006955) |
GO component: | extracellular region (GO:0005576) |
GO function: | growth factor activity (GO:0008083), interleukin-7 receptor binding (GO:0005139) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IL7