The domain within your query sequence starts at position 129 and ends at position 220; the E-value for the ILEI domain shown below is 8.9e-28.
RGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDEGSFHLKDT AKALLRSLGSQAGPALGWRDTWAFVGRKGGPV
ILEI |
![]() |
---|
PFAM accession number: | PF15711 |
---|---|
Interpro abstract (IPR039477): | This entry represents the ILEI/PANDER domain found in FAM3 family members and related proteins. Both PANDER and ILEI share a similar beta-beta-alpha fold, strikingly different from the classical cytokines [ (PUBMED:23333428) ]. FAM3C, also known as interleukin-like EMT inducer ILEI, is a secreted signaling protein involved in epithelial-mesenchymal transition and tumor progression [ (PUBMED:28751379) ]. FAM3B, also known as PANDER (PANcreatic DERived factor), is a cytokine-like protein that induces apoptosis of insulin-secreting beta-cells [ (PUBMED:12941769) ] and functions as a hormone by regulating glucose levels [ (PUBMED:21664909) ]. The fold of the stem domain of POMGnT1 (O-linked mannose beta1,2-N-acetylglucosaminyltransferase 1) resembles that of PANDER [ (PUBMED:27493216) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ILEI