The domain within your query sequence starts at position 420 and ends at position 620; the E-value for the IMS domain shown below is 1.9e-43.
VDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGTAPLRPGANPQLEWQYYQNRALRGKAAD IPDSSVWENQDSTQTNGIDSVLSKAEIASCSYEARQVGIKNGMFFGYAKQLCPNLQAVPY DFHACREVAQAMYETLASYTHSIEAVSCDEALIDVTDILAETKLSPEEFAAALRIEIKDK TKCAASVGIGSNILLARMATK
IMS |
![]() |
---|
PFAM accession number: | PF00817 |
---|---|
Interpro abstract (IPR001126): | In Escherichia coli, UV and many chemicals appear to cause mutagenesis by a process of translesion synthesis that requires DNA polymerase III and the SOS-regulated proteins UmuD, UmuC and RecA. This machinery allows the replication to continue through DNA lesion, and therefore avoid lethal interruption of DNA replication after DNA damage [ (PUBMED:9560379) ]. UmuC is a well conserved protein in prokaryotes, with a homologue in yeast species. Proteins known to contain an UmuC domain are listed below:
|
GO process: | DNA repair (GO:0006281) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IMS