The domain within your query sequence starts at position 157 and ends at position 189; the E-value for the IMS_HHH domain shown below is 1.7e-9.
PESCQHLIHSLNHIKEIPGIGYKTAKRLEVLGI
IMS_HHH |
---|
PFAM accession number: | PF11798 |
---|---|
Interpro abstract (IPR024728): | This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [ (PUBMED:21295588) ]. This type of polymerases are thought to be involved in UV protection and mutation [ (PUBMED:2989816) (PUBMED:10458907) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IMS_HHH