SMART: Pfam domain INCENP

The domain within your query sequence starts at position 6 and ends at position 41; the E-value for the INCENP_N domain shown below is 1.9e-18.

PGPICLLDLCDQKLLDFVCNVDNKDFMWLKEIEEEA

INCENP_N

PFAM accession number:	PF12178
Interpro abstract (IPR022006):	This domain family is found in eukaryotes, and is approximately 40 amino acids in length. INCENP is a regulatory protein in the chromosome passenger complex. It is involved in regulation of the catalytic protein Aurora B. It performs this function in association with two other proteins - Survivin and Borealin. These proteins form a tight three-helical bundle. The N-terminal domain is the domain involved in formation of this three helical bundle.

PFAM accession number:

PF12178

Interpro abstract (IPR022006):

This domain family is found in eukaryotes, and is approximately 40 amino acids in length. INCENP is a regulatory protein in the chromosome passenger complex. It is involved in regulation of the catalytic protein Aurora B. It performs this function in association with two other proteins - Survivin and Borealin. These proteins form a tight three-helical bundle. The N-terminal domain is the domain involved in formation of this three helical bundle.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry INCENP_N