The domain within your query sequence starts at position 23 and ends at position 69; the E-value for the INSC_LBD domain shown below is 8.3e-34.
MQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDTQGDLILAGGPG
INSC_LBD |
![]() |
---|
PFAM accession number: | PF16748 |
---|---|
Interpro abstract (IPR031938): | This is the LGN-binding domain (LBD) of the inscuteable homologue protein. It interacts with the TPR motifs of G-protein-signaling modulator 2 (GPSM2, also known as LGN) and stabilises LGN [ (PUBMED:22074847) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry INSC_LBD