The domain within your query sequence starts at position 1 and ends at position 103; the E-value for the INSIG domain shown below is 1.1e-42.

MRCVAVFVGINHASAKVDFDNNFQFSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVV
TQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLA

INSIG

INSIG
PFAM accession number:PF07281
Interpro abstract (IPR025929):

This family contains a number of eukaryotic Insulin-induced proteins (INSIG-1 and INSIG-2) approximately 200 residues long. INSIG-1 and INSIG-2 are found in the endoplasmic reticulum and bind the sterol-sensing domain of SREBP cleavage-activating protein (SCAP), preventing it from escorting SREBPs to the Golgi. Their combined action permits feedback regulation of cholesterol synthesis over a wide range of sterol concentrations [ (PUBMED:12202038) (PUBMED:12242332) ].

The INSIG family also includes NSG1 and NSG2 (INSIG homologues 1 and 2) [ (PUBMED:16270032) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry INSIG