The domain within your query sequence starts at position 24 and ends at position 140; the E-value for the INTS2 domain shown below is 1e-48.
VVRLASLSDPELRLLLPCLVRMALCAPADQSQSWAQDKKLILRLLSGVEAVNSIVALLSV DFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSPRRLRLVLSELL
INTS2 |
![]() |
---|
PFAM accession number: | PF14750 |
---|---|
Interpro abstract (IPR029321): | This family of proteins are subunits of the integrator complex involved in snRNA transcription and processing [ (PUBMED:16239144) ]. |
GO component: | integrator complex (GO:0032039) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry INTS2