The domain within your query sequence starts at position 803 and ends at position 865; the E-value for the INT_SG_DDX_CT_C domain shown below is 4e-30.
EVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQ LEN
INT_SG_DDX_CT_C |
---|
PFAM accession number: | PF15300 |
---|---|
Interpro abstract (IPR029307): | This domain is found at the C terminus of integrator complex subunit 6 (INTS6) [ (PUBMED:16239144) ], sarcoma antigen 1 (SAGE1) [ (PUBMED:10919659) ], protein DDX26B and members of the cancer/testis antigen family 45 [ (PUBMED:15905330) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry INT_SG_DDX_CT_C