The domain within your query sequence starts at position 2468 and ends at position 2530; the E-value for the IR1-M domain shown below is 2.5e-27.
DILIVYELTPTPEQKALAEKLLLPSTFFCYKNRPGYVSEEEEDDEDYEMAVKKLNGKLYL DDS
IR1-M |
![]() |
---|
PFAM accession number: | PF12185 |
---|---|
Interpro abstract (IPR022011): | This domain family is found in eukaryotes, and is approximately 60 amino acids in length. The family is found in association with . There are two conserved sequence motifs: TFFC and EDF. Nup358/RanBP2 is a nucleoporin involved in ubiquitination of many different protein targets from various cellular pathways. It complexes with Ubc9, SUMO-1 and RanGAP1 to perform this function. This is the ligase domain which binds to Ubc9. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IR1-M