The domain within your query sequence starts at position 21 and ends at position 166; the E-value for the IZUMO domain shown below is 2.6e-53.
PCIKCDQFVTDALKTFENTYLNDHLPHDIHKNVMRMVNHEVSSFGVVTSAEDSYLGAVDE NTLEQATWSFLKDLKRITDSDLKGELFIKELLWMLRHQKDIFNNLARQFQKEVLCPNKCG VMSQTLIWCLKCEKQLHICRKSLDCG
IZUMO |
![]() |
---|
PFAM accession number: | PF15005 |
---|---|
Interpro abstract (IPR029389): | IZUMO is a protein with a single immunoglobulin (Ig) domain. Its expression has been found to be testis-specific [ (PUBMED:1) (PUBMED:2) ]. IZUMO is not detectable on the surface of fresh sperm, but becomes exposed after an exocytotic process, the acrosome reaction, has occurred. It is thought to bind to putative Izumo receptors on the oocyte. Studies have shown that knock-out mice (Izumo-/- males) were sterile despite normal mating behaviour and ejaculation, indicating the importance of the protein in fertilisation [ (PUBMED:16574441) ]. IZUMO is a typical type I membrane glycoprotein with one immunoglobulin-like domain and a putative N-glycoside link motif (Asn 204) [ (PUBMED:15759005) ]. It contains cysteine residues thought to form a disulphide bridge, and a conserved GCL sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IZUMO