The domain within your query sequence starts at position 135 and ends at position 213; the E-value for the Ifi-6-16 domain shown below is 2.2e-30.
IGGALAVAGAPIALSAVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGIL GLSTSTNIILGAVGAATGA
Ifi-6-16 |
---|
PFAM accession number: | PF06140 |
---|---|
Interpro abstract (IPR009311): | This entry represents interferon alpha-inducible proteins IFI6 (also known as IFI-6-16) and IFI27-like (also known as ISG12) [ (PUBMED:14728724) ]. ISG12a is a mitochondrial protein that contributes to IFN-induced apoptosis through perturbation of normal mitochondrial function [ (PUBMED:18330707) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ifi-6-16