The domain within your query sequence starts at position 46 and ends at position 171; the E-value for the Ima1_N domain shown below is 1.1e-43.
VNCWFCNHDTLVPYGNRNCWDCPHCEQYNGFQENGDYNKPIPAQYMEHLNHVVSSVPSPR DPAQPQQWVSSQVLLCRRCSHHQTTKIKQLAAFTPREEGRYDEEIEVYRHHLEQMYKLCR PCQAAV
Ima1_N |
---|
PFAM accession number: | PF09779 |
---|---|
Interpro abstract (IPR018617): | This domain occurs at the N terminus of the Schizosaccharomyces pombe inner nuclear membrane protein, Ima1. Ima1 interacts with other inner nuclear membrane proteins [ (PUBMED:21880100) (PUBMED:22156748) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ima1_N