The domain within your query sequence starts at position 261 and ends at position 351; the E-value for the Ion_trans_2 domain shown below is 5.9e-13.
LITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQ TWVGKTIASCFSVFAISFFALPAGILGSGFA
Ion_trans_2 |
---|
PFAM accession number: | PF07885 |
---|---|
Interpro abstract (IPR013099): | This domain is found in a variety of potassium channel proteins, including the two membrane helix type ion channels found in bacteria [ (PUBMED:11836519) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ion_trans_2