The domain within your query sequence starts at position 218 and ends at position 261; the E-value for the Ion_trans_N domain shown below is 1.2e-23.

FGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDF

Ion_trans_N

Ion_trans_N
PFAM accession number:PF08412
Interpro abstract (IPR013621):

This domain is found to the N terminus of IPR005821 in voltage- and cyclic nucleotide-gated K/Na ion channels.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ion_trans_N