The domain within your query sequence starts at position 423 and ends at position 493; the E-value for the JIP_LZII domain shown below is 3.1e-32.
FGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLE NRIKELEEELK
JIP_LZII |
![]() |
---|
PFAM accession number: | PF16471 |
---|---|
Interpro abstract (IPR032486): | This is the second leucine zipper domain (LZII) of several JNK-interacting proteins (JIP). It interacts with the small GTP-binding protein ARF6 [ (PUBMED:19644450) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry JIP_LZII