The domain within your query sequence starts at position 79 and ends at position 138; the E-value for the JSRP domain shown below is 1e-29.
DDLPWGDLTLNKCLVLASLVALLGSALQLCRDAVAGEVVAAPHPWVPPSSPPKKEASPAP
JSRP |
![]() |
---|
PFAM accession number: | PF15312 |
---|---|
Interpro abstract (IPR026178): | Junctional sarcoplasmic reticulum protein 1 (JSRP1, also known as JP-45) may regulate voltage-sensitive calcium channel CACNA1S membrane targeting and activity [ (PUBMED:16638807) ]. The protein may also have a role in the development or maintenance of skeletal muscle strength [ (PUBMED:18077436) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry JSRP