The domain within your query sequence starts at position 10 and ends at position 186; the E-value for the Jiraiya domain shown below is 1e-50.
LAAMTLLGIPAAVLVALAAQLLFQLQAGRAELRRVRTDGLHPELDPDAGLPEAAAGALLP LATALAALAQVLGLSCLLLAALCGHLGAELARGPGPGRSDWFLYDCRLLRHSALGLFCCG VSVYLAALAIYALLLFEIEAGAAAASILGSGALILVAIMTHTLFRAVQATRRGLREL
Jiraiya |
---|
PFAM accession number: | PF15038 |
---|---|
Interpro abstract (IPR029201): | The membrane protein Jiraiya from Xenopus inhibits bone morphogenetic protein (BMP) signalling during embryogenesis [ (PUBMED:20951346) ]. The human member of this family is uncharacterised protein TMEM221 (transmembrane protein 221). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Jiraiya