The domain within your query sequence starts at position 29 and ends at position 186; the E-value for the Jnk-SapK_ap_N domain shown below is 1e-72.

VSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNE
QLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQIS
RLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQ

Jnk-SapK_ap_N

• PFAM accession number: PF09744
• Interpro abstract (IPR019143):

  This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans. Most of the proteins in this entry have a RhoGEF domain ( IPR000219 ) at their C-terminal end.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Jnk-SapK_ap_N