SMART: Pfam domain KAP

The domain within your query sequence starts at position 440 and ends at position 953; the E-value for the KAP_NTPase domain shown below is 1.2e-112.

YDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSW
LIVFLILLLCGGLGLVFAFTVDTNLAIAVSLSFLALLYIFFIVIYFGGRQEGESWNWAWA
LSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIA
TLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAI
FRVDPKHLTVNAILISIASIVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSE
GFMKVLKCEVELMARMAKTIDSFTQNQTRLVVIIDGLDACEQDKVLQMLDTVRVLFSKGP
FIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTS
ATNGDISCSEATGVQEDADRRVSQNSLGEMTKLGSKTALNRRDTYRRRQMQRTITRQMSF
DLTKLLVTEDWFSDISPQTMRRLLNIVSVTGRLL

KAP_NTPase

PFAM accession number:	PF07693
Interpro abstract (IPR011646):	The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [ (PUBMED:15128444) ].

PFAM accession number:

PF07693

Interpro abstract (IPR011646):

The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [ (PUBMED:15128444) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KAP_NTPase