The domain within your query sequence starts at position 362 and ends at position 474; the E-value for the KAsynt_C_assoc domain shown below is 8.2e-46.
PNPEIPALLDGRLQVVDRPLPVRGGNVGINSFGFGGSNVHVILQPNTRQAPAPTAHAALP HLLHASGRTLEAVQDLLEQGRQHSQDLAFVSMLNDIAATPTAAMPFRGYTVLG
KAsynt_C_assoc |
 |
|---|
| PFAM accession number: | PF16197 |
|---|---|
| Interpro abstract (IPR032821): | This entry represents the very C terminus of a group of polyketide synthases. Polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations [ (PUBMED:11548049) ]. Proteins containing this domain can be found in proteins ranging from bacteria to human. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KAsynt_C_assoc