The domain within your query sequence starts at position 805 and ends at position 851; the E-value for the KIF1B domain shown below is 3.9e-15.

LRQRLDLMREMYDRAAEVPSSVVEDCDNVVTGGDPFYDRFPWFRLVG

KIF1B

KIF1B
PFAM accession number:PF12423
Interpro abstract (IPR022140):

This domain is found in kinesin-like proteins and is approximately 50 amino acids in length. It is found in some kinesin-3 family members, such as KIF1, KIF13, KIF28 [ (PUBMED:24706892) ] and unc-104 [ (PUBMED:17643120) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KIF1B