The domain within your query sequence starts at position 125 and ends at position 267; the E-value for the KR domain shown below is 1.4e-9.
KVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLDL AVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQ DVLCRSSPARVIVVSSESHRFTD
KR |
![]() |
---|
PFAM accession number: | PF08659 |
---|---|
Interpro abstract (IPR013968): | This domain is found in polyketide and fatty acid synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group [ (PUBMED:23790488) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KR