SMART: Pfam domain KRTAP7

The domain within your query sequence starts at position 1 and ends at position 84; the E-value for the KRTAP7 domain shown below is 5.6e-50.

MTRYFCCGNYFPGYPCYGTNFHGTYRATPLNCVVPLGSPLNHGCGTMYSSRNFCYGGISN
FSNPGCCYGSSLYRPWGSGSGFGY

KRTAP7

PFAM accession number:	PF15034
Interpro abstract (IPR020184):	This family includes keratin-associated protein 7-1, a member of the type 7 family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulphide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulphur and high-glycine-tyrosine keratins. Other groups of keratin-associated proteins include IPR007951 and IPR021743 .

PFAM accession number:

PF15034

Interpro abstract (IPR020184):

This family includes keratin-associated protein 7-1, a member of the type 7 family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulphide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulphur and high-glycine-tyrosine keratins.

Other groups of keratin-associated proteins include IPR007951 and IPR021743 .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KRTAP7