The domain within your query sequence starts at position 23 and ends at position 102; the E-value for the KRTDAP domain shown below is 9.1e-43.
AALGHPTIYPEDSSYNNYPTATEGLNNEFLNFKRLQSAFQSENFLNWHVITDMFKNAFPF INWDFFPKVKGLRSAAPDSQ
KRTDAP |
---|
PFAM accession number: | PF15200 |
---|---|
Interpro abstract (IPR028196): | Keratinocyte differentiation-associated protein (KRTDAP) is secreted by keratinocytes and may serve as a soluble regulator of keratinocyte differentiation [ (PUBMED:15140226) ]. |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KRTDAP