The domain within your query sequence starts at position 23 and ends at position 91; the E-value for the KRTDAP domain shown below is 5.2e-41.
AALGHPTIYPEDSSYNNYPTATEGLNNEFLNFKRLQSAFQSENFLNWHVITDMFKNAFPF INWDFFPKT
KRTDAP |
 |
|---|
| PFAM accession number: | PF15200 |
|---|---|
| Interpro abstract (IPR028196): | Keratinocyte differentiation-associated protein (KRTDAP) is secreted by keratinocytes and may serve as a soluble regulator of keratinocyte differentiation [ (PUBMED:15140226) ]. |
| GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KRTDAP