The domain within your query sequence starts at position 36 and ends at position 218; the E-value for the KTI12 domain shown below is 1e-8.
TVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEA MRVRKQCALAALRDVKSYLTKEGGQIAVFDATNTTRERRHMILNFAKENDFKAFFIESVC DDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRINCYEASYQPLDPDKCDRDLSLIKV IDV
KTI12 |
---|
PFAM accession number: | PF08433 |
---|---|
Interpro abstract (IPR013641): | Protein KTI12 is a chromatin associated protein that interacts with the Elongator complex, a component of the elongating form of RNA polymerase II [ (PUBMED:15772087) ]. The Elongator complex has histone acetyltransferase activity. L-seryl-tRNA(Sec) kinase (PSTK) specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis [ (PUBMED:15317934) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KTI12