The domain within your query sequence starts at position 68 and ends at position 227; the E-value for the K_oxygenase domain shown below is 1.7e-11.
CYSDFPFREDYPNFMSHEKFWDYLREFAEHFGLLRYIRFKTTVLSVTKRPDFSETGQWDV VTETEGKRDRAVFDAVMVCTGQFLSPHLPLESFPGIHKFKGQILHSQEYRIPDAFRGKRI LVVGLGNTGGDIAVELSEIAAQVFLSTRTGTWVLSRSSPG
K_oxygenase |
![]() |
---|
PFAM accession number: | PF13434 |
---|---|
Interpro abstract (IPR025700): | This is a family of Rossmann fold oxidoreductases that catalyse NADPH-dependent hydroxylation and are involved in siderophore biosynthesis. This family includes L-ornithine 5-monooxygenase, which catalyses the hydroxylation of L-ornithine at the N5 position [ (PUBMED:8106324) ], and L-lysine 6-monooxygenase, which catalyses the hydroxylation of lysine at the N6 position [ (PUBMED:16461464) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry K_oxygenase