The domain within your query sequence starts at position 3 and ends at position 98; the E-value for the Keratin_matx domain shown below is 2.1e-50.
CCVARCCSVPTGPATTICSSDKSCRCGVCLPSTCPHTIWQLEPTCCDNCPPPCHIPQPCV PTCFLLNSCHPTPDLLTVNLTTYVQPGCEEPCVPRC
Keratin_matx |
---|
PFAM accession number: | PF04579 |
---|---|
Interpro abstract (IPR007659): | This is a family of keratins, high-sulphur matrix proteins. The keratin products of mammalian epidermal derivatives such as wool and hair consist of microfibrils embedded in a rigid matrix of other proteins. The matrix proteins include the high-sulphur and high-tyrosine keratins, having molecular weights of 6-20kDa, whereas microfibrils contain the larger, low-sulphur keratins (40-56kDa) [ (PUBMED:4678578) ]. |
GO component: | keratin filament (GO:0045095) |
GO function: | structural molecule activity (GO:0005198) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Keratin_matx