The domain within your query sequence starts at position 1 and ends at position 123; the E-value for the Kinocilin domain shown below is 4.5e-77.
MDIPISTRDFRCLQLACVALGLVAGSIIIGVSVSKAAAAVGGIFLGAAGLGLLIFAYPFL KARFNLDHILPAIGNLRIHPNSGPDHGEGRSSNNSNKEGARSGLSTVTRTLEKLKPGGRG TEE
Kinocilin |
---|
PFAM accession number: | PF15033 |
---|---|
Interpro abstract (IPR027837): | The kinocilin family of proteins is found in vertebrates. In mouse it has been shown that this protein is expressed primarily in the kinocilium of sensory cells in the inner ear [ (PUBMED:15855039) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kinocilin