The domain within your query sequence starts at position 507 and ends at position 595; the E-value for the Kri1_C domain shown below is 8.4e-37.
LDEYYRLDYEDIIDDLPCRFKYRTVVPCDFGLSTEEILSADDKELNRWCSLKKTCMYRSE QEEMQEQRVYSQKAQNMWKKRQIFKSLCQ
Kri1_C |
 |
|---|
| PFAM accession number: | PF12936 |
|---|---|
| Interpro abstract (IPR024626): | The yeast member of the Kri1-like family (Kri1p) is found to be required for 40S ribosome biogenesis in the nucleolus [ (PUBMED:11027267) ]. This entry represents the C-terminal domain of this protein family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kri1_C