The domain within your query sequence starts at position 507 and ends at position 595; the E-value for the Kri1_C domain shown below is 8.4e-37.

LDEYYRLDYEDIIDDLPCRFKYRTVVPCDFGLSTEEILSADDKELNRWCSLKKTCMYRSE
QEEMQEQRVYSQKAQNMWKKRQIFKSLCQ

Kri1_C

Kri1_C
PFAM accession number:PF12936
Interpro abstract (IPR024626):

The yeast member of the Kri1-like family (Kri1p) is found to be required for 40S ribosome biogenesis in the nucleolus [ (PUBMED:11027267) ]. This entry represents the C-terminal domain of this protein family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kri1_C