The domain within your query sequence starts at position 470 and ends at position 555; the E-value for the Ku_C domain shown below is 3.1e-31.

TYRSDSFENPVLQQHFRNLEALALDMMESEQVVDLTLPKVEAIKKRLGSLADEFKELVYP
PGYNPEGKVAKRKQDDEGSTSKKPKV

Ku_C

Ku_C
PFAM accession number:PF03730
Interpro abstract (IPR005160):

The Ku heterodimer (composed of Ku70 P12956 and Ku80 P13010 ) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway. This is the C-terminal arm. This alpha helical region embraces the beta-barrel domain IPR006164 of the opposite subunit [ (PUBMED:11493912) ].

GO process:double-strand break repair via nonhomologous end joining (GO:0006303)
GO function:DNA binding (GO:0003677), DNA helicase activity (GO:0003678)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ku_C