The domain within your query sequence starts at position 476 and ends at position 570; the E-value for the Ku_C domain shown below is 6.9e-23.
LFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCESPLSKVKT LFPLTEVIKKKNQVTAQDVFQDNHEEGPAAKKYKT
Ku_C |
 |
|---|
| PFAM accession number: | PF03730 |
|---|---|
| Interpro abstract (IPR005160): | The Ku heterodimer (composed of Ku70 P12956 and Ku80 P13010 ) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway. This is the C-terminal arm. This alpha helical region embraces the beta-barrel domain IPR006164 of the opposite subunit [ (PUBMED:11493912) ]. |
| GO process: | double-strand break repair via nonhomologous end joining (GO:0006303) |
| GO function: | DNA binding (GO:0003677), DNA helicase activity (GO:0003678) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ku_C