The domain within your query sequence starts at position 55 and ends at position 142; the E-value for the LAMTOR5 domain shown below is 2e-36.

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAARLTSDPT
DIPVVCLESDNGNIMIQKHDGITVAVHK

LAMTOR5

LAMTOR5
PFAM accession number:PF16672
Interpro abstract (IPR024135):

Hepatitis B X-interacting protein (HBXIP, also known as LAMTOR5) was originally recognised for its association with the X protein of hepatitis B virus (HBV) and ability to down-regulate HBV replication [ (PUBMED:9499022) ]. When complexed to the anti-apoptotic protein survivin, HBXIP interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerised APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway [ (PUBMED:12773388) ]. HBXIP is one of the Ragulator components that are required for mTORC1 activation by amino acids [ (PUBMED:22980980) ]. It is also part of the AA (amino acid) sensing machinery in human CD4+ T cells [ (PUBMED:26084023) ].

GO process:negative regulation of cysteine-type endopeptidase activity involved in apoptotic process (GO:0043154), negative regulation of apoptotic process (GO:0043066)
GO component:Ragulator complex (GO:0071986), cytoplasm (GO:0005737)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAMTOR5