The domain within your query sequence starts at position 120 and ends at position 384; the E-value for the LETM1 domain shown below is 1.2e-102.
LRQKIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPF MVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKTMAAKLEIAKFLQETMTEMA RRNRAKLGDASSQLSSYVKQVQTGHKPSTKEIVRFSKLFKDQLALEHLDRPQLVALCKLL ELQTFGTNNLLRFQLLMTLKSIKADDEIIAKEGVKALSVSELQSACRARGMRSLGLTEEQ LCQQLTGWLDLHLKENVPPSLLLLS
LETM1 |
![]() |
---|
PFAM accession number: | PF07766 |
---|---|
Interpro abstract (IPR011685): | This is a group of mainly hypothetical eukaryotic proteins. Putative features found in LETM1, such as a transmembrane domain and a CK2 and PKC phosphorylation site [ (PUBMED:10486213) ], are relatively conserved throughout the family. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans [ (PUBMED:10486213) ]. A member of this family, P91927 is known to be expressed in the mitochondria of Drosophila melanogaster [ (PUBMED:10071211) ], suggesting that this may be a group of mitochondrial proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LETM1