SMART: Pfam domain LIAS

The domain within your query sequence starts at position 4 and ends at position 110; the E-value for the LIAS_N domain shown below is 5.8e-49.

NYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKT
ARNPPPLDANEPDNTAKAIAEWGLDYVVLTSVDRDDVADGGAEHIAK

LIAS_N

PFAM accession number:	PF16881
Interpro abstract (IPR031691):	Lipoyl synthase is an iron-sulphur protein [ (PUBMED:10403368) ]. It is localised to mitochondria in yeast and Arabidopsis [ (PUBMED:8349643) (PUBMED:12062419) ]. It generates lipoic acid, a thiol antioxidant that is linked to a specific Lys as prosthetic group for the pyruvate and alpha-ketoglutarate dehydrogenase complexes and the glycine-cleavage system. This domain is found in the N terminus of lipoyl synthases.

PFAM accession number:

PF16881

Interpro abstract (IPR031691):

Lipoyl synthase is an iron-sulphur protein [ (PUBMED:10403368) ]. It is localised to mitochondria in yeast and Arabidopsis [ (PUBMED:8349643) (PUBMED:12062419) ]. It generates lipoic acid, a thiol antioxidant that is linked to a specific Lys as prosthetic group for the pyruvate and alpha-ketoglutarate dehydrogenase complexes and the glycine-cleavage system.

This domain is found in the N terminus of lipoyl synthases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LIAS_N