The domain within your query sequence starts at position 18 and ends at position 112; the E-value for the LIN52 domain shown below is 1.1e-42.
LLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTT ANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILE
LIN52 |
 |
|---|
| PFAM accession number: | PF10044 |
|---|---|
| Interpro abstract (IPR018737): | LIN52 is a component of the DREAM (MuvB/DRM) complex which represses cell cycle-dependent genes in quiescent cells and plays a role in the cell cycle-dependent activation of G2/M genes [ (PUBMED:17531812) (PUBMED:17671431) ]. |
| GO process: | transcription, DNA-templated (GO:0006351) |
| GO component: | DRM complex (GO:0070176) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LIN52