The domain within your query sequence starts at position 43 and ends at position 174; the E-value for the LRAT domain shown below is 1.4e-44.
SSFVRGDVLEVSRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGVI CKVASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCE HFVTYCRYGSRI
LRAT |
---|
PFAM accession number: | PF04970 |
---|---|
Interpro abstract (IPR007053): | This domain is found in a variety of proteins, including lecithin retinol acyltransferase (LRAT), HRAS-like suppressors (HRASLS1-5) and proteins FAM84A and FAM84B. Acyltransferase LRAT is the main enzyme that catalyzes vitamin A esterification [ (PUBMED:16174770) ]. HRASLS enzymes are also referred to as LRAT-like proteins because of their sequence homology to LRAT. LRAT and LRAT-like proteins share a common catalytic domain fold represented by this entry [ (PUBMED:22605381) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRAT