The domain within your query sequence starts at position 861 and ends at position 914; the E-value for the LRRC37 domain shown below is 2.8e-9.
VSQQIIIVHPPKHPLVIYSEQVHTQHPNPTEATAQPLNLELILTSQPTAEGELP
LRRC37 |
![]() |
---|
PFAM accession number: | PF15779 |
---|---|
Interpro abstract (IPR032754): | This domain is found in vertebrates, and is approximately 70 amino acids in length. The function of this domain is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRRC37