SMART: Pfam domain LRR

The domain within your query sequence starts at position 148 and ends at position 244; the E-value for the LRR_5 domain shown below is 5.1e-5.

YSTDIFFILEITDNPYMTSVPENAFQGLCNETLTLKLYNNGFTSVQGHAFNGTKLDAVYL
NKNKYLTAIDNDAFGGVYSGPTLLDVSSTSVTALPSK

LRR_5

PFAM accession number:	PF13306
Interpro abstract (IPR026906):	This repeat is found in a large number of BSPA-like surface antigens from Trichomonas vaginalis. This entry represents a leucine rich repeat. A leucine-rich repeat (LRR) is a protein structural motif that forms an alpha/beta horseshoe fold [ (PUBMED:7817399) (PUBMED:14747988) ]. Leucine-rich repeats are frequently involved in the formation of protein protein interactions [ (PUBMED:11751054) (PUBMED:1657640) ].

PFAM accession number:

PF13306

Interpro abstract (IPR026906):

This repeat is found in a large number of BSPA-like surface antigens from Trichomonas vaginalis.

This entry represents a leucine rich repeat. A leucine-rich repeat (LRR) is a protein structural motif that forms an alpha/beta horseshoe fold [ (PUBMED:7817399) (PUBMED:14747988) ]. Leucine-rich repeats are frequently involved in the formation of protein protein interactions [ (PUBMED:11751054) (PUBMED:1657640) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRR_5