The domain within your query sequence starts at position 201 and ends at position 249; the E-value for the LSR domain shown below is 1.9e-23.

EWVFVGLVILGIFLFFVLVGICWCQCCPHSCCCYVRCPCCPDSCCCPQA

LSR

 LSR
PFAM accession number:PF05624
Interpro abstract (IPR008664):

This domain consists of mammalian LISCH7 protein homologues. LISCH7 is a liver-specific BHLH-ZIP transcription factor.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LSR