The domain within your query sequence starts at position 226 and ends at position 454; the E-value for the LacY_symp domain shown below is 3.9e-8.

GKQSFWKLVTLPKMGLLAFVIISLSSCFGFLDPTLSLFVMEKFSLSTGYVGLVFLGLSLS
YAISSPLFGLLSDKMPTLRKWLLVFGNLITAGCYMLLGPVPLLHIKSQLWLLVLVLVVNG
ISAGMSIIPTFPEMLSCAYANGFEDSISTLGLVSGLFGAMWSVGAFMGPILGGFLCEKIG
FEWAAAMQGLWTLLSGVSMALFYLWEDSTARRRSKAQNSLGTEEERAAL

LacY_symp

LacY_symp
PFAM accession number:PF01306
Interpro abstract (IPR000576):

In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [ (PUBMED:8438231) ]. The lacY family of Escherichia coli and Klebsiella pneumoniae are proton/beta-galactoside symporters, which, like most sugar transporters, are integral membrane proteins with 12 predicted transmembrane (TM) regions. Also similar to the lacY family are the rafinose (rafB) and sucrose (cscB) permeases from E. coli [ (PUBMED:1435727) ] and melibiose permease (melY) from Enterobacter cloacae [ (PUBMED:9209070) ].

GO process:carbohydrate transport (GO:0008643)
GO component:membrane (GO:0016020)
GO function:carbohydrate:proton symporter activity (GO:0005351)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LacY_symp