The domain within your query sequence starts at position 28 and ends at position 172; the E-value for the Las1 domain shown below is 6e-45.

VSWLSRAEWEQVTVYLFCDDHKLQQYALNRITVWRSRLGNELPLAVASTADLVRCKLIDA
AGTLGTDELRLLYGMALVRFVNLISERKTKCSNLPLKYLAQEVNIPDWIVELRHNLTHKK
MPHINECRRGCYFVLNWLQKTYWSR

Las1

 Las1
PFAM accession number:PF04031
Interpro abstract (IPR007174):

Las1 is an endoribonuclease responsible for cleavage at the C2 site during pre-rRNA processing [ (PUBMED:29440475) ]. It interacts with Grc3 polynucleotide kinase and is required for ribosome synthesis [ (PUBMED:23175604) ]. Las1-mediated C2 cleavage depends on the functional integrity of the associated Grc3 phosphotransferase, while phosphorylation of the 26S pre-rRNA by Grc3 relies on a functionally competent Las1 nuclease [ (PUBMED:28652339) (PUBMED:26638174) ].

GO process:rRNA processing (GO:0006364)
GO component:Las1 complex (GO:0090730)
GO function:endonuclease activity (GO:0004519)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Las1