The domain within your query sequence starts at position 28 and ends at position 172; the E-value for the Las1 domain shown below is 6e-45.
VSWLSRAEWEQVTVYLFCDDHKLQQYALNRITVWRSRLGNELPLAVASTADLVRCKLIDA AGTLGTDELRLLYGMALVRFVNLISERKTKCSNLPLKYLAQEVNIPDWIVELRHNLTHKK MPHINECRRGCYFVLNWLQKTYWSR
Las1 |
---|
PFAM accession number: | PF04031 |
---|---|
Interpro abstract (IPR007174): | Las1 is an endoribonuclease responsible for cleavage at the C2 site during pre-rRNA processing [ (PUBMED:29440475) ]. It interacts with Grc3 polynucleotide kinase and is required for ribosome synthesis [ (PUBMED:23175604) ]. Las1-mediated C2 cleavage depends on the functional integrity of the associated Grc3 phosphotransferase, while phosphorylation of the 26S pre-rRNA by Grc3 relies on a functionally competent Las1 nuclease [ (PUBMED:28652339) (PUBMED:26638174) ]. |
GO process: | rRNA processing (GO:0006364) |
GO component: | Las1 complex (GO:0090730) |
GO function: | endonuclease activity (GO:0004519) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Las1