The domain within your query sequence starts at position 1 and ends at position 117; the E-value for the Leu_zip domain shown below is 4.3e-60.
XLVEETFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDI SELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKAVNALDE
Leu_zip |
 |
|---|
| PFAM accession number: | PF15294 |
|---|---|
| Interpro abstract (IPR026157): | The functions of this family are unclear. Human LZTFL1 is ubiquitously expressed [ (PUBMED:11352561) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Leu_zip