The domain within your query sequence starts at position 1 and ends at position 114; the E-value for the Lipin_N domain shown below is 8.5e-54.

MNYVGQLAGQVLVTVKELYKGINQATLSGCIDVVVVRQQDGSYQCSPFHVRFGKLGVLRS
KEKVIDIEINGSAVDLHMKLGDNGEAFFVEETEEEYEKLPAYLATSPIPTEDQF

Lipin_N

Lipin_N
PFAM accession number:PF04571
Interpro abstract (IPR007651):

Mutations in the lipin gene lead to fatty liver dystrophy in mice. The protein has been shown to be phosphorylated by the TOR Ser/Thr protein kinases in response to insulin stimulation. This entry represents a conserved domain found at the N terminus of the member proteins [ (PUBMED:11138012) (PUBMED:11792863) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lipin_N