The domain within your query sequence starts at position 504 and ends at position 596; the E-value for the Lipin_mid domain shown below is 6.1e-37.
VTLSLCGGLSENGEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYNRYYNWALAAPMI LSLQVFQKSLPKATVESWVKDKMPKKSGRWWFW
Lipin_mid |
---|
PFAM accession number: | PF16876 |
---|---|
Interpro abstract (IPR031703): | This is a middle domain of lipins. Overall the enzyme acts as a magnesium-dependent phosphatidate phosphatase enzyme that catalyses the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis ( EC 5.2.1.8 ) [ (PUBMED:17158099) (PUBMED:22134922) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lipin_mid