SMART: Pfam domain MAP17

The domain within your query sequence starts at position 68 and ends at position 181; the E-value for the MAP17 domain shown below is 2.4e-35.

MLAFSLLVLGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIVFAVNHFWCQEEPE
PGSTVMIIGNKADGVLVGMDGRYSSMASGFRSSEHKNAYENVLEEEGRVRSTPM

MAP17

PFAM accession number:	PF15807
Interpro abstract (IPR031627):	PDZK1-interacting protein 1 (PDZK1IP1, MAP17) is a small non-glycosylated two-pass membrane protein that is overexpressed in many tumours of different origins, including carcinomas [ (PUBMED:8701988) (PUBMED:9461128) (PUBMED:12812916) (PUBMED:22465409) ]. This entry also includes small integral membrane protein 24 (SMIM24) from mammals and proximal tubules-expressed gene protein (pteg) from Xenopus. The function of SMIM24 is not clear. Pteg is essential for pronephric mesoderm specification and tubulogenesis [ (PUBMED:19909807) ].

PFAM accession number:

PF15807

Interpro abstract (IPR031627):

PDZK1-interacting protein 1 (PDZK1IP1, MAP17) is a small non-glycosylated two-pass membrane protein that is overexpressed in many tumours of different origins, including carcinomas [ (PUBMED:8701988) (PUBMED:9461128) (PUBMED:12812916) (PUBMED:22465409) ].

This entry also includes small integral membrane protein 24 (SMIM24) from mammals and proximal tubules-expressed gene protein (pteg) from Xenopus. The function of SMIM24 is not clear. Pteg is essential for pronephric mesoderm specification and tubulogenesis [ (PUBMED:19909807) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAP17