The domain within your query sequence starts at position 458 and ends at position 565; the E-value for the MAP2_projctn domain shown below is 1.1e-52.

DKVADVSISEVTTLLGNVHSPVVEGYVGENISGEVKVTTDQEKKETSAPSVQEPTLTETE
PQTKLDEKSTVSIEEAVAKKEESFKLRDDKTGVIQTSTEQSFSKEDQK

MAP2_projctn

MAP2_projctn
PFAM accession number:PF08377
Interpro abstract (IPR013588):

This domain is found in the microtubule-associated protein 2 (MAP2)/Tau family of proteins which includes MAP2, MAP4, Tau, and their homologues. All isoforms contain a conserved C-terminal domain containing tubulin-binding repeats ( IPR001084 ), and a N-terminal projection domain of varying size. This domain has a net negative charge and exerts a long-range repulsive force. This provides a mechanism that can regulate microtubule spacing which might facilitate efficient organelle transport [ (PUBMED:15642108) (PUBMED:11576531) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAP2_projctn