The domain within your query sequence starts at position 28 and ends at position 102; the E-value for the MBDa domain shown below is 5.5e-28.
QKRRETQIVPKKIKAKHRTGVTSKDSMRMTSCIFAKPVTTITSYPENETRYRREEDKLTK PKQLCALKRLKKHQV
MBDa |
 |
|---|
| PFAM accession number: | PF16564 |
|---|---|
| Interpro abstract (IPR032343): | This entry represents a second MBD domain of methyl-CpG-binding domain proteins 2 and 3. This region has been implicated in binding the RbAp46/48 (retinoblastoma protein-associated protein) homologue p55, which is one of the components of the MBD2-NuRD complex. The MBD2-NuRD complex is a nucleosome remodelling and deacetylation complex [ (PUBMED:21490301) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MBDa